Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Odocoileus virginianus virginianus Medium-wave-sensitive opsin 1 (OPN1MW)

This Recombinant Odocoileus virginianus virginianus Medium-wave-sensitive opsin 1 (OPN1MW) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 1, Green cone photoreceptor pigment, Green-sensitive opsin

UniProt

O18911

Expression Region

1-273

Origin

Odocoileus virginianus virginianus (Virginia white-tailed deer)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APRWVYHLTSAWMVFVVIASVFTNGLVLAATMRFKKLRHPLNWILVNLAIADLVETIIAS TISVVNQMYGYFVLGHPLCVVEGYTASLCGITGLWSLAIISWERWMVVCRPFGNVRFDAK LAIAGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITC CFIPLSVIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVMVMIFAFCLCWGPYAFF ACFAAAHPGYAFHPLVAALPAYFAKSATIYNPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ank3 (NM_146005) Mouse Tagged ORF Clone
MR215342 10 µg

Ank3 (NM_146005) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal Prolactin R Antibody (SPM213) [PerCP]
NBP2-34746PCP 0.1 mL

Mouse Monoclonal Prolactin R Antibody (SPM213) [PerCP]

Sign In for Pricing
View Details
Duck Acetyl Coenzyme A Carboxylase Alpha ELISA Kit
MBS078537 Inquire

Duck Acetyl Coenzyme A Carboxylase Alpha ELISA Kit

Sign In for Pricing
View Details
(S) -3-Amino-3- (4-bromophenyl) propan-1-ol
OR93208-01 100 mg

(S) -3-Amino-3- (4-bromophenyl) propan-1-ol

Sign In for Pricing
View Details
(S) -3-Amino-3- (4-bromophenyl) propan-1-ol
OR93208-02 250 mg

(S) -3-Amino-3- (4-bromophenyl) propan-1-ol

Sign In for Pricing
View Details
(S) -3-Amino-3- (4-bromophenyl) propan-1-ol
OR93208-03 1 g

(S) -3-Amino-3- (4-bromophenyl) propan-1-ol

Sign In for Pricing
View Details