Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

P67386

Expression Region

1-273

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVVLGLLFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTTGDIPMFAVGFITAFVVALI AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC17 Rabbit Polyclonal Antibody (Cy7)
orb1071336 100 µL

MUC17 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
C1QL2 (NM_182528) Human Over-expression Lysate
LS165257-20ug 20 µg

C1QL2 (NM_182528) Human Over-expression Lysate

Sign In for Pricing
View Details
Hamartin, Phosphorylated (Ser505) (TSC1, Tuberous Sclerosis 1 Protein, KIAA0243, TSC) (FITC)
MBS6479422-01 0.2 mL

Hamartin, Phosphorylated (Ser505) (TSC1, Tuberous Sclerosis 1 Protein, KIAA0243, TSC) (FITC)

Sign In for Pricing
View Details
Hamartin, Phosphorylated (Ser505) (TSC1, Tuberous Sclerosis 1 Protein, KIAA0243, TSC) (FITC)
MBS6479422-02 5x 0.2 mL

Hamartin, Phosphorylated (Ser505) (TSC1, Tuberous Sclerosis 1 Protein, KIAA0243, TSC) (FITC)

Sign In for Pricing
View Details
Human G1/S-specific cyclin-D1 ELISA Kit
MBS2884023-01 48 Well

Human G1/S-specific cyclin-D1 ELISA Kit

Sign In for Pricing
View Details
Human G1/S-specific cyclin-D1 ELISA Kit
MBS2884023-02 96 Well

Human G1/S-specific cyclin-D1 ELISA Kit

Sign In for Pricing
View Details