Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nocardioides sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Nocardioides sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A1SJZ1

Expression Region

1-274

Origin

Nocardioides sp. (strain BAA-499 / JS614)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDFLQALVLGLIQGLTEFLPISSSAHLRIYPELFGWGDPGAAFTAVIQIGTEVAVLMFF RKDIWRIGRAWLLSLFKPEYRGHLDARMGWFIIVGSVPIVLLGIALKDVIEEDFRSLWLI GTTLIVLGLVLGVADRLGGTDKTIKQISLRDAILMGLAQALALIPGVSRSGATLSMGRLL GYDREAATRYAFLLAIPAVIGAGVFELKDIPNGDNLYGWGPTIVATIVSFVVGYAAIAWL LRYVTTRSYAPFVLYRVALGAATLVLVATGVIAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lin28B Recombinant Rabbit Monoclonal Antibody [JE04-80]
HA722688 100 µL

Lin28B Recombinant Rabbit Monoclonal Antibody [JE04-80]

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3145), CF740 conjugate, 0.1mg/mL
BNC743145-500 1x 500 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3145), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SNAPC5 Antibody
8C10201-AAT 50 µg

SNAPC5 Antibody

Sign In for Pricing
View Details
IPO-38 Proliferation marker Mouse Monoclonal Antibody [Clone ID: SPM260]
AM33249PU-S 100 µg

IPO-38 Proliferation marker Mouse Monoclonal Antibody [Clone ID: SPM260]

Sign In for Pricing
View Details
APC Anti-Human CD73 Antibody[AD2]
E-AB-F1242E-01 20 Tests

APC Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details
APC Anti-Human CD73 Antibody[AD2]
E-AB-F1242E-02 100 Tests

APC Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details