Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nocardioides sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Nocardioides sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A1SJZ1

Expression Region

1-274

Origin

Nocardioides sp. (strain BAA-499 / JS614)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDFLQALVLGLIQGLTEFLPISSSAHLRIYPELFGWGDPGAAFTAVIQIGTEVAVLMFF RKDIWRIGRAWLLSLFKPEYRGHLDARMGWFIIVGSVPIVLLGIALKDVIEEDFRSLWLI GTTLIVLGLVLGVADRLGGTDKTIKQISLRDAILMGLAQALALIPGVSRSGATLSMGRLL GYDREAATRYAFLLAIPAVIGAGVFELKDIPNGDNLYGWGPTIVATIVSFVVGYAAIAWL LRYVTTRSYAPFVLYRVALGAATLVLVATGVIAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (EPO104), 0.2mg/mL
BNUB0104-100 1x 100 µL

Eosinophil Peroxidase (EPO104), 0.2mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799), CF647 conjugate, 0.1mg/mL
BNC470799-100 1x 100 µL

Cytokeratin 19 (KRT19/799), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD89 (FCAR) (Center) Rabbit Polyclonal Antibody
AP51639PU-N 400 µL

CD89 (FCAR) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DND1 Rabbit Polyclonal Antibody
TA372435 100 µL

DND1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FBXO25 Mouse Monoclonal Antibody [Clone ID: OTI1A1]
CF810350 100 µg

FBXO25 Mouse Monoclonal Antibody [Clone ID: OTI1A1]

Sign In for Pricing
View Details
Cig2 (3A11/5), CF647 conjugate, 0.1mg/mL
BNC472827-100 1x 100 µL

Cig2 (3A11/5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details