Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Transmembrane protein US18 (US18)

This Recombinant Human cytomegalovirus Transmembrane protein US18 (US18) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Transmembrane protein US18

UniProt

F5HE69

Expression Region

1-274

Origin

Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDTASVSEHHESPTVTIVPLHRSHALVAEQQLFQWLKRFKLLMEVYHGLVWQLACTLTV CLLAWLAFPDVQGQCANGIVPALSSIVPVSTLAMLRGFAEFRPHTTNFAHLTVACLLINT GITVCTGFCGERRVIGLSFALVMVFFVLCSGLTYLAGNNPTRWKVIGIGYGWSVIVFYLL LYFSPVLWVSKIYSGLYVLVVTAASAVLIYETLDLIYQRGTLSKNSVCVSVVLYTIVMSL LNMSVAIFSGHVWVQQYAEKHGGRIDGVSLLSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aniline Hydrochloride
TRC-A662508-500MG 500 mg

Aniline Hydrochloride

Sign In for Pricing
View Details
Polystyrene C4 PHB
HB04508013.100G 100 g

Polystyrene C4 PHB

Sign In for Pricing
View Details
Mouse Ifna5 activation kit by CRISPRa
GA202074 1 Kit

Mouse Ifna5 activation kit by CRISPRa

Sign In for Pricing
View Details
SUOX (NM_000456) Human Recombinant Protein
TP309066 20 µg

SUOX (NM_000456) Human Recombinant Protein

Sign In for Pricing
View Details
Human Factor XII (F12) activation kit by CRISPRa
GA101506 1 Kit

Human Factor XII (F12) activation kit by CRISPRa

Sign In for Pricing
View Details
(3-((2-(Aziridin-1-yl)ethyl)amino)propyl)phosphonic Acid
TRC-A408330-25MG 25 mg

(3-((2-(Aziridin-1-yl)ethyl)amino)propyl)phosphonic Acid

Sign In for Pricing
View Details