Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Transmembrane protein US18 (US18)

This Recombinant Human cytomegalovirus Transmembrane protein US18 (US18) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Transmembrane protein US18

UniProt

F5HE69

Expression Region

1-274

Origin

Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDTASVSEHHESPTVTIVPLHRSHALVAEQQLFQWLKRFKLLMEVYHGLVWQLACTLTV CLLAWLAFPDVQGQCANGIVPALSSIVPVSTLAMLRGFAEFRPHTTNFAHLTVACLLINT GITVCTGFCGERRVIGLSFALVMVFFVLCSGLTYLAGNNPTRWKVIGIGYGWSVIVFYLL LYFSPVLWVSKIYSGLYVLVVTAASAVLIYETLDLIYQRGTLSKNSVCVSVVLYTIVMSL LNMSVAIFSGHVWVQQYAEKHGGRIDGVSLLSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lesinurad
TRC-L329700-5MG 5 mg

Lesinurad

Sign In for Pricing
View Details
YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF647 conjugate, 0.1mg/mL
BNC472430-500 1x 500 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/777), CF647 conjugate, 0.1mg/mL
BNC471863-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/777), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Smooth muscle
CR561947 5 µg

Tissue Total RNA, Smooth muscle

Sign In for Pricing
View Details
Allyl Acetate
TRC-A549015-50G 50 g

Allyl Acetate

Sign In for Pricing
View Details
PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF740 conjugate, 0.1mg/mL
BNC741104-500 1x 500 µL

PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details