Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dechloromonas aromatica Undecaprenyl-diphosphatase (uppP)

This Recombinant Dechloromonas aromatica Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q478U2

Expression Region

1-274

Origin

Dechloromonas aromatica (strain RCB)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPILLLKALILGIVEGLTEFLPISSTGHLILAGDLLNFNDDRGKLFEIVIQSGAILAVV WEYRERLLKVARGAFSEPAAQKFILNLFVAFLPLAILGLAFGRAIKAHLFNPVTVASTFI LGAFVILWAERREHKIRIQTVDEMSMLDALKLGIAQAFALIPGTSRSGATIIGGLLFGLS RKAATEFSFFLAIPTLIVATFYQLYKERALLNADDLAMWAVGFVAAFVSAFLCVRWLLRY ISTHDFTAFAWYRIAFGIVVLATWQFGWVQWAAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Nitroso Cilazapril
TRC-N105740-50MG 50 mg

N-Nitroso Cilazapril

Sign In for Pricing
View Details
Histone H1.0 Recombinant Rabbit Monoclonal Antibody [SD206-04]
ET1612-24 100 µL

Histone H1.0 Recombinant Rabbit Monoclonal Antibody [SD206-04]

Sign In for Pricing
View Details
prothymosin, alpha (PTMA) Rabbit Polyclonal Antibody
AP02227SU-N 100 µL

prothymosin, alpha (PTMA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TIM 4 (TIMD4) (NM_001146726) Human Over-expression Lysate
LC431308 20 µg

TIM 4 (TIMD4) (NM_001146726) Human Over-expression Lysate

Sign In for Pricing
View Details
NQO1 Recombinant Rabbit Monoclonal Antibody [JF440-1]
ET1702-50 100 µL

NQO1 Recombinant Rabbit Monoclonal Antibody [JF440-1]

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (CDH16/1071), CF405S conjugate, 0.1mg/mL
BNC041071-100 1x 100 µL

Ksp-Cadherin / CDH16 (CDH16/1071), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details