Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dechloromonas aromatica Undecaprenyl-diphosphatase (uppP)

This Recombinant Dechloromonas aromatica Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q478U2

Expression Region

1-274

Origin

Dechloromonas aromatica (strain RCB)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPILLLKALILGIVEGLTEFLPISSTGHLILAGDLLNFNDDRGKLFEIVIQSGAILAVV WEYRERLLKVARGAFSEPAAQKFILNLFVAFLPLAILGLAFGRAIKAHLFNPVTVASTFI LGAFVILWAERREHKIRIQTVDEMSMLDALKLGIAQAFALIPGTSRSGATIIGGLLFGLS RKAATEFSFFLAIPTLIVATFYQLYKERALLNADDLAMWAVGFVAAFVSAFLCVRWLLRY ISTHDFTAFAWYRIAFGIVVLATWQFGWVQWAAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgE Mouse Monoclonal Antibody [Clone ID: 4H10]
AM03073FC-N 100 µg

Human IgE Mouse Monoclonal Antibody [Clone ID: 4H10]

Sign In for Pricing
View Details
DHX35 (NM_001190809) Human Over-expression Lysate
LC434365 20 µg

DHX35 (NM_001190809) Human Over-expression Lysate

Sign In for Pricing
View Details
Fluo-3, AM Ester, Special Packag, 20x50ug
#50016 20x 50 µg

Fluo-3, AM Ester, Special Packag, 20x50ug

Sign In for Pricing
View Details
SLC35G2 (NM_001097600) Human Over-expression Lysate
LY420394 100 µg

SLC35G2 (NM_001097600) Human Over-expression Lysate

Sign In for Pricing
View Details
Human LYRIC (MTDH) activation kit by CRISPRa
GA114185 1 Kit

Human LYRIC (MTDH) activation kit by CRISPRa

Sign In for Pricing
View Details
(3alpha,5alpha)-3,17-Dihydroxypregnan-20-one
TRC-D863770-50MG 50 mg

(3alpha,5alpha)-3,17-Dihydroxypregnan-20-one

Sign In for Pricing
View Details