Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dechloromonas aromatica Undecaprenyl-diphosphatase (uppP)

This Recombinant Dechloromonas aromatica Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q478U2

Expression Region

1-274

Origin

Dechloromonas aromatica (strain RCB)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPILLLKALILGIVEGLTEFLPISSTGHLILAGDLLNFNDDRGKLFEIVIQSGAILAVV WEYRERLLKVARGAFSEPAAQKFILNLFVAFLPLAILGLAFGRAIKAHLFNPVTVASTFI LGAFVILWAERREHKIRIQTVDEMSMLDALKLGIAQAFALIPGTSRSGATIIGGLLFGLS RKAATEFSFFLAIPTLIVATFYQLYKERALLNADDLAMWAVGFVAAFVSAFLCVRWLLRY ISTHDFTAFAWYRIAFGIVVLATWQFGWVQWAAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

beta Catenin (CTNNB1) (327-331) Rabbit Polyclonal Antibody
AP26073PU-N 100 µL

beta Catenin (CTNNB1) (327-331) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(+)-Strigolactone GR24
TRC-S687600-25MG 25 mg

(+)-Strigolactone GR24

Sign In for Pricing
View Details
HLAB (HLA-B) Rabbit Polyclonal Antibody
TA368265 100 µL

HLAB (HLA-B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(R)-Cetirizine Dihydrochloride
TRC-C281106-25MG 25 mg

(R)-Cetirizine Dihydrochloride

Sign In for Pricing
View Details
Ataxin 3 (ATXN3) (NM_001127696) Human Over-expression Lysate
LC426854 20 µg

Ataxin 3 (ATXN3) (NM_001127696) Human Over-expression Lysate

Sign In for Pricing
View Details
CD239/BCAM Polyclonal Antibody
E-AB-90946-01 60 µL

CD239/BCAM Polyclonal Antibody

Sign In for Pricing
View Details