Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable formate transporter (fdhC)

This Recombinant Probable formate transporter (fdhC) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Probable formate transporter

UniProt

Q50568

Expression Region

1-274

Origin

Methanobacterium thermoformicicum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSSFKSPADTAKACSAIAELKEKAPLGKVIVLSFLAGAYIAFGGLLAEVVTGGMAKAGY PAGLVKLVFGAVFPVGLMLVVIAGSELFTGNCMYMPLGILDKRASIMGLIRNWVTSWVFN LVGAVFVAYFLAVATGILTADPWQAGALTVAKTKALGGASFIAAGKVTKSLTWAQAFWRA VGCNWLVCLAVYLAIASDDIIGKIWGIWFPIFAFVAIGFEHSVANMFFIPVGIFLGGVTW SQFFMNNLIPVTLGNIVGGAIFVACLYWYTYLKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDYYFEER (TFA)
HY-P5318A 1 Each

MDYYFEER (TFA)

Sign In for Pricing
View Details
Syk Inhibitor IV, BAY 61-3606 HCl
466696-01 2 mg

Syk Inhibitor IV, BAY 61-3606 HCl

Sign In for Pricing
View Details
Syk Inhibitor IV, BAY 61-3606 HCl
466696-02 4 mg

Syk Inhibitor IV, BAY 61-3606 HCl

Sign In for Pricing
View Details
Transient Receptor potential cation channel subfamily V member 4 (TRPV4) Mouse ELISA Kit
H7795 96 Tests

Transient Receptor potential cation channel subfamily V member 4 (TRPV4) Mouse ELISA Kit

Sign In for Pricing
View Details
4-Bromo-1- (2- (t-butyldimethylsilyloxy) ethyl) pyrazole
430518-01 100 mg

4-Bromo-1- (2- (t-butyldimethylsilyloxy) ethyl) pyrazole

Sign In for Pricing
View Details
4-Bromo-1- (2- (t-butyldimethylsilyloxy) ethyl) pyrazole
430518-02 250 mg

4-Bromo-1- (2- (t-butyldimethylsilyloxy) ethyl) pyrazole

Sign In for Pricing
View Details