Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable formate transporter (fdhC)

This Recombinant Probable formate transporter (fdhC) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Probable formate transporter

UniProt

Q50568

Expression Region

1-274

Origin

Methanobacterium thermoformicicum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSSFKSPADTAKACSAIAELKEKAPLGKVIVLSFLAGAYIAFGGLLAEVVTGGMAKAGY PAGLVKLVFGAVFPVGLMLVVIAGSELFTGNCMYMPLGILDKRASIMGLIRNWVTSWVFN LVGAVFVAYFLAVATGILTADPWQAGALTVAKTKALGGASFIAAGKVTKSLTWAQAFWRA VGCNWLVCLAVYLAIASDDIIGKIWGIWFPIFAFVAIGFEHSVANMFFIPVGIFLGGVTW SQFFMNNLIPVTLGNIVGGAIFVACLYWYTYLKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGALS9, NT (LGALS9, Galectin-9, Ecalectin, Tumor antigen HOM-HD-21) (PE)
MBS6315854-01 0.2 mL

LGALS9, NT (LGALS9, Galectin-9, Ecalectin, Tumor antigen HOM-HD-21) (PE)

Sign In for Pricing
View Details
LGALS9, NT (LGALS9, Galectin-9, Ecalectin, Tumor antigen HOM-HD-21) (PE)
MBS6315854-02 5x 0.2 mL

LGALS9, NT (LGALS9, Galectin-9, Ecalectin, Tumor antigen HOM-HD-21) (PE)

Sign In for Pricing
View Details
RASGEF1C Peptide
DF9809-BP 1 mg

RASGEF1C Peptide

Sign In for Pricing
View Details
Anti-CD272/BTLA Antibody Picoband®, Cy3 Conjugate
A03149-Cy3 100 µg/Vial

Anti-CD272/BTLA Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Recombinant Legionella pneumophila Iron-sulfur cluster insertion protein ErpA (erpA)
MBS1199866-01 0.02 mg (E-Coli)

Recombinant Legionella pneumophila Iron-sulfur cluster insertion protein ErpA (erpA)

Sign In for Pricing
View Details
Recombinant Legionella pneumophila Iron-sulfur cluster insertion protein ErpA (erpA)
MBS1199866-02 0.1 mg (E-Coli)

Recombinant Legionella pneumophila Iron-sulfur cluster insertion protein ErpA (erpA)

Sign In for Pricing
View Details