Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable formate transporter (fdhC)

This Recombinant Probable formate transporter (fdhC) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Probable formate transporter

UniProt

Q50568

Expression Region

1-274

Origin

Methanobacterium thermoformicicum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSSFKSPADTAKACSAIAELKEKAPLGKVIVLSFLAGAYIAFGGLLAEVVTGGMAKAGY PAGLVKLVFGAVFPVGLMLVVIAGSELFTGNCMYMPLGILDKRASIMGLIRNWVTSWVFN LVGAVFVAYFLAVATGILTADPWQAGALTVAKTKALGGASFIAAGKVTKSLTWAQAFWRA VGCNWLVCLAVYLAIASDDIIGKIWGIWFPIFAFVAIGFEHSVANMFFIPVGIFLGGVTW SQFFMNNLIPVTLGNIVGGAIFVACLYWYTYLKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Myc shRNA (UAS) - Lentiviral mouse Myc shRNA (UAS, RFP) (25)
GTR15238499 1 Vial

Lentiviral mouse Myc shRNA (UAS) - Lentiviral mouse Myc shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Anti-Bovine Serum Albumin/BSA Antibody (6F8)
BY411053-01 50 µg

Anti-Bovine Serum Albumin/BSA Antibody (6F8)

Sign In for Pricing
View Details
Anti-Bovine Serum Albumin/BSA Antibody (6F8)
BY411053-02 100 µg

Anti-Bovine Serum Albumin/BSA Antibody (6F8)

Sign In for Pricing
View Details
Anti-Bovine Serum Albumin/BSA Antibody (6F8)
BY411053-03 1 mg

Anti-Bovine Serum Albumin/BSA Antibody (6F8)

Sign In for Pricing
View Details
Lentiviral mouse Kars shRNA (UAS) - Lentiviral mouse Kars shRNA (UAS) (100)
GTR15256926 1 Vial

Lentiviral mouse Kars shRNA (UAS) - Lentiviral mouse Kars shRNA (UAS) (100)

Sign In for Pricing
View Details
CD45RO (T200, GP180, LCA, Leukocyte Common Antigen, LY5, Receptor-type tyrosine-Protein phosphatase C, T200 GlycoProtein) (BSA & Azide Free) (MaxLight 750) discontinued
172054-AF-ML750 100 µL

CD45RO (T200, GP180, LCA, Leukocyte Common Antigen, LY5, Receptor-type tyrosine-Protein phosphatase C, T200 GlycoProtein) (BSA & Azide Free) (MaxLight 750) discontinued

Sign In for Pricing
View Details