Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lemur catta Cytochrome c oxidase subunit 3 (MT-CO3)

This Recombinant Lemur catta Cytochrome c oxidase subunit 3 (MT-CO3) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, Cytochrome c oxidase polypeptide III

UniProt

Q8LX26

Expression Region

1-274

Origin

Lemur catta (Ring-tailed lemur)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHQTHAYHMVNPSPWPLTGALSALLMTSGLAMWFHFNSSMLLSLGMLTNLLTMYQWWRD IVREGTFQGHHTSIVQKGLRYGMVLFIISEIFFFAGFFWAFYHSSLAPTPELGGCWPPTG IHPLNPLEVPLLNTAVLLASGVSITWAHHSLMEGNRVQMLQALLITITLGLYFTLLQASE YFETSFTISDGVYGSTFFMATGFHGLHVIIGSTFLTVCFFRQLSFHFTSNHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGSYSFSIDPMQLTSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARTN Antibody
KC-27595-01 50 μL

ARTN Antibody

Sign In for Pricing
View Details
ARTN Antibody
KC-27595-02 100 µL

ARTN Antibody

Sign In for Pricing
View Details
ARTN Antibody
KC-27595-03 1 mL

ARTN Antibody

Sign In for Pricing
View Details
VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/2865), CF405S conjugate, 0.1mg/mL
BNC042865-500 1x 500 µL

VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/2865), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p38 (CRK) (NM_016823) Human Over-expression Lysate
LY402580 100 µg

p38 (CRK) (NM_016823) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ALS2 activation kit by CRISPRa
GA111678 1 Kit

Human ALS2 activation kit by CRISPRa

Sign In for Pricing
View Details