Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lemur catta Cytochrome c oxidase subunit 3 (MT-CO3)

This Recombinant Lemur catta Cytochrome c oxidase subunit 3 (MT-CO3) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, Cytochrome c oxidase polypeptide III

UniProt

Q8LX26

Expression Region

1-274

Origin

Lemur catta (Ring-tailed lemur)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHQTHAYHMVNPSPWPLTGALSALLMTSGLAMWFHFNSSMLLSLGMLTNLLTMYQWWRD IVREGTFQGHHTSIVQKGLRYGMVLFIISEIFFFAGFFWAFYHSSLAPTPELGGCWPPTG IHPLNPLEVPLLNTAVLLASGVSITWAHHSLMEGNRVQMLQALLITITLGLYFTLLQASE YFETSFTISDGVYGSTFFMATGFHGLHVIIGSTFLTVCFFRQLSFHFTSNHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGSYSFSIDPMQLTSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (T-Cell Marker) (UCHT1), CF647 conjugate, 0.1mg/mL
BNC472473-500 1x 500 µL

CD3e (T-Cell Marker) (UCHT1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
V5 tag, AlpHcAbs® Rabbit antibody (HRP)
HA710015 100 µg

V5 tag, AlpHcAbs® Rabbit antibody (HRP)

Sign In for Pricing
View Details
ASS1 (C-term) Rabbit Polyclonal Antibody
AP50278PU-N 400 µL

ASS1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant ANGPT1 Antibody
RC-4519-01 50 μL

Recombinant ANGPT1 Antibody

Sign In for Pricing
View Details
Recombinant ANGPT1 Antibody
RC-4519-02 100 µL

Recombinant ANGPT1 Antibody

Sign In for Pricing
View Details
Recombinant ANGPT1 Antibody
RC-4519-03 1 mL

Recombinant ANGPT1 Antibody

Sign In for Pricing
View Details