Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium acetobutylicum Undecaprenyl-diphosphatase 1 (uppP1)

This Recombinant Clostridium acetobutylicum Undecaprenyl-diphosphatase 1 (uppP1) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase 1, EC= 3.6.1.27, Bacitracin resistance protein 1, Undecaprenyl pyrophosphate phosphatase 1

UniProt

Q97LQ3

Expression Region

1-274

Origin

Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHIEILKAIFLGIVEGITEWLPISSTGHMILVNEFIRLNVTEAFKQVFLVVIQLGAILS VVLLYFNKLIPFSLNGGFYLKKDVVSMWIKIIISCIPATIVGIPFDDKIDALFYNYQTVS ITLISFGILFIMIENHNKGKHPRITSISEITYTTAVLIGIFQLIAAVFPGTSRSGATIVG ALLIGVSRTVAAEYTFFLAIPVMFGASLLKLFKFGLHFTSTEITILFIGMLSAFIVSILA IKFLMIYIKRHDFKAFGWYRIILGCAVLVYFLIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-100 1x 100 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
BNC401820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-100 1x 100 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-100 1x 100 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-500 1x 500 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-100 1x 100 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details