Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus halodurans Undecaprenyl-diphosphatase 1 (uppP1)

This Recombinant Bacillus halodurans Undecaprenyl-diphosphatase 1 (uppP1) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase 1, EC= 3.6.1.27, Bacitracin resistance protein 1, Undecaprenyl pyrophosphate phosphatase 1

UniProt

Q9KFL5

Expression Region

1-274

Origin

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEWSQELWLLIKYLLLGLFQGFTEPIPVSSSGHLVLLQHFLGIEIEGLSFEVMVNFASLF AVIAIYRFDLLKLVKGSARYVLYQDAQGKGDFRISFYLLLATVPAVLAALLFKDWIETEL KQLHVIAFALLITGMALWLIRHLNGRKQDGDITLKDALLVGLAQTAALIPGISRSGATIV AAMGLGWRQETALRFSFFLYIPISLGSGVLAISDIVQDPHFTALWIPYTIAFIGSFIASY VSLLWFMNIMRHGKLIYFALYCWLAGLIVLSLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40, Mouse (FGK45.5), CF647 conjugate, 0.1mg/mL
BNC472005-100 1x 100 µL

CD40, Mouse (FGK45.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COL9A2 Human Gene Knockout Kit (CRISPR)
KN423776 1 Kit

COL9A2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (3E6), CF647 conjugate, 0.1mg/mL
BNC471777-500 1x 500 µL

Prostate Specific Antigen (PSA) (3E6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid protein (P13L, R203K, G204R, G214C), His Tag
NUN-C52Ha-1mg 1 mg

SARS-CoV-2 Nucleocapsid protein (P13L, R203K, G204R, G214C), His Tag

Sign In for Pricing
View Details
HIF1 beta (ARNT) (NM_001668) Human Over-expression Lysate
LC400636 20 µg

HIF1 beta (ARNT) (NM_001668) Human Over-expression Lysate

Sign In for Pricing
View Details
Ultrasonic Homogenizer BLIH-311
BLIH-311 1 Unit

Ultrasonic Homogenizer BLIH-311

Sign In for Pricing
View Details