Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

P80439

Expression Region

1-274

Origin

Allomyces macrogynus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKKLINQFKSFQVHPYHLVEPSPWPLGASVACLILTLGGVMKFHGFAAGDIGLPLGLIL VLASMLLWWRDVIREATYQGHHTKTVKYGITLGVVLFIVSEILLFFSLFWAFFHSSLAPS VELGSTWPPVGIEPLNPFEVPLLNTIILLTSGCTITVSHAKIISGDRGATILYLILTILL AWMFLGLQWVEYVNAPFTIADSVYGSTFFVATGFHGLHVMIGTIFLTVSLNRILSYHLTS GHHLGYEAAIWYWHVVDVIWLFLYVSVYYWGSNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Aminooxazole-5-carboxylic acid
415463-01 100 mg

2-Aminooxazole-5-carboxylic acid

Sign In for Pricing
View Details
2-Aminooxazole-5-carboxylic acid
415463-02 250 mg

2-Aminooxazole-5-carboxylic acid

Sign In for Pricing
View Details
Mouse IgG F (ab') 2 Antibody
orb750707 2 mL

Mouse IgG F (ab') 2 Antibody

Sign In for Pricing
View Details
hsa-miR-758-3p Primers
MPH03868 150 µL / 10 µM

hsa-miR-758-3p Primers

Sign In for Pricing
View Details
HSPA9, ID (HSPA9, GRP75, HSPA9B, Stress-70 protein, mitochondrial, 75kD glucose-regulated protein, Heat shock 70kD protein 9, Mortalin, Peptide-binding protein 74) (FITC) discontinued
036805-FITC 200 µL

HSPA9, ID (HSPA9, GRP75, HSPA9B, Stress-70 protein, mitochondrial, 75kD glucose-regulated protein, Heat shock 70kD protein 9, Mortalin, Peptide-binding protein 74) (FITC) discontinued

Sign In for Pricing
View Details
Mouse Stromal Cell Derived Factor 1 Beta (SDF-1β) ELISA Kit
orb1947095-01 48 Tests

Mouse Stromal Cell Derived Factor 1 Beta (SDF-1β) ELISA Kit

Sign In for Pricing
View Details