Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

P80439

Expression Region

1-274

Origin

Allomyces macrogynus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKKLINQFKSFQVHPYHLVEPSPWPLGASVACLILTLGGVMKFHGFAAGDIGLPLGLIL VLASMLLWWRDVIREATYQGHHTKTVKYGITLGVVLFIVSEILLFFSLFWAFFHSSLAPS VELGSTWPPVGIEPLNPFEVPLLNTIILLTSGCTITVSHAKIISGDRGATILYLILTILL AWMFLGLQWVEYVNAPFTIADSVYGSTFFVATGFHGLHVMIGTIFLTVSLNRILSYHLTS GHHLGYEAAIWYWHVVDVIWLFLYVSVYYWGSNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ndufa11 shRNA (UAS) - Lentiviral mouse Ndufa11 shRNA (UAS, iRFP) (100)
GTR15178299 1 Vial

Lentiviral mouse Ndufa11 shRNA (UAS) - Lentiviral mouse Ndufa11 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
KLHL24, ID (KLHL24, DRE1, Kelch-like protein 24, Kainate receptor-interacting protein for GluR6, Protein DRE1) (MaxLight 490) discontinued
037553-ML490 100 µL

KLHL24, ID (KLHL24, DRE1, Kelch-like protein 24, Kainate receptor-interacting protein for GluR6, Protein DRE1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Fadrozole hydrochloride
MBS3845688-01 5 mg

Fadrozole hydrochloride

Sign In for Pricing
View Details
Fadrozole hydrochloride
MBS3845688-02 10 mg

Fadrozole hydrochloride

Sign In for Pricing
View Details
Fadrozole hydrochloride
MBS3845688-03 50 mg

Fadrozole hydrochloride

Sign In for Pricing
View Details
Fadrozole hydrochloride
MBS3845688-04 100 mg

Fadrozole hydrochloride

Sign In for Pricing
View Details