Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Transmembrane protein US18 (US18)

This Recombinant Human cytomegalovirus Transmembrane protein US18 (US18) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Transmembrane protein US18

UniProt

P69334

Expression Region

1-274

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDTASVSEHHESPTVTIVPLHRSHALVAEQQLFQWLKRFKLLMEVYHGLVWQLACTLTV CLLAWLAFPDVQGQCANGIVPALSSIVPVSTLAMLRGFAEFRPHTTNFAHLTVACLLINT GITVCTGFCGERRVIGLSFALVMVFFVLCSGLTYLAGNNPTRWKVIGIGYGWSVIVFYLL LYFSPVLWVSKIYSGLYVLVVTAASAVLIYETLDLIYQRGTLSKNSVCVSVVLYTIVMSL LNMSVAIFSGHVWVQQYAEKHGGRIDGVSLLSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAUR Mouse Monoclonal Antibody [Clone ID: FC-E2]
TA384992 100 µg

PLAUR Mouse Monoclonal Antibody [Clone ID: FC-E2]

Sign In for Pricing
View Details
C13orf8 (CHAMP1) Rabbit Polyclonal Antibody
TA367899 100 µL

C13orf8 (CHAMP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mkrn2os Mouse Gene Knockout Kit (CRISPR)
KN500268 1 Kit

Mkrn2os Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Acyclovir N-Ethyl-L-valinate
TRC-A618605-10MG 10 mg

Acyclovir N-Ethyl-L-valinate

Sign In for Pricing
View Details
N-Cyclohexylpropyl Deoxynojirimycin, Hydrochloride
TRC-C988160-1MG 1 mg

N-Cyclohexylpropyl Deoxynojirimycin, Hydrochloride

Sign In for Pricing
View Details
Superoxide Dismutase 1 (SOD1) Human Gene Knockout Kit (CRISPR)
KN200725BN 1 Kit

Superoxide Dismutase 1 (SOD1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details