Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Transmembrane protein US18 (US18)

This Recombinant Human cytomegalovirus Transmembrane protein US18 (US18) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Transmembrane protein US18

UniProt

P69334

Expression Region

1-274

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDTASVSEHHESPTVTIVPLHRSHALVAEQQLFQWLKRFKLLMEVYHGLVWQLACTLTV CLLAWLAFPDVQGQCANGIVPALSSIVPVSTLAMLRGFAEFRPHTTNFAHLTVACLLINT GITVCTGFCGERRVIGLSFALVMVFFVLCSGLTYLAGNNPTRWKVIGIGYGWSVIVFYLL LYFSPVLWVSKIYSGLYVLVVTAASAVLIYETLDLIYQRGTLSKNSVCVSVVLYTIVMSL LNMSVAIFSGHVWVQQYAEKHGGRIDGVSLLSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Thyroid gland
CS505862 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
PIK3AP1 Antibody
KC-3628-01 50 μL

PIK3AP1 Antibody

Sign In for Pricing
View Details
PIK3AP1 Antibody
KC-3628-02 100 µL

PIK3AP1 Antibody

Sign In for Pricing
View Details
PIK3AP1 Antibody
KC-3628-03 1 mL

PIK3AP1 Antibody

Sign In for Pricing
View Details
CD81 Recombinant Monoclonal Mouse Antibody (2304.81), CF®405M Conjugate - Biotium Choice
P014-405M-125 1x 125 µL

CD81 Recombinant Monoclonal Mouse Antibody (2304.81), CF®405M Conjugate - Biotium Choice

Sign In for Pricing
View Details
PAX7 (PAX7/497), CF543 conjugate, 0.1mg/mL
BNC430497-100 1x 100 µL

PAX7 (PAX7/497), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details