Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alkaline ceramidase 2 (Acer2)

This Recombinant Mouse Alkaline ceramidase 2 (Acer2) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Alkaline ceramidase 2, AlkCDase 2, Alkaline CDase 2, maCER2, EC= 3.5.1.23, Acylsphingosine deacylase 3-like, Cancer-related gene liver 1 protein

UniProt

Q8VD53

Expression Region

1-275

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAPHWWDHLRAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFILPPICMCLFRQYATCF NSGIYLIWTLLVVVGIGSVYFHATLSFLGQMLDELAILWVLMCALAMWFPRRYLPKIFRN DRGRFKAVVCVLSAITTCLAFIKPAINNISLMILGLPCTALLVAELKRCDNVRVFKLGLF SGLWWTLALFCWISDQAFCELLSSFHFPYLHCVWHILICLASYLGCVCFAYFDAASEIPE QGPVIRFWPSEKWAFIGVPYVSLLCAHKKSPVKIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl2l11 Mouse Pre-designed siRNA Set A
HY-RS01428 1 Set

Bcl2l11 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Site-Saturation Mutagenesis Library Service [RFQ]
GTR14653351 1 Each

Site-Saturation Mutagenesis Library Service [RFQ]

Sign In for Pricing
View Details
Anti-C9/Complement Component C9 Rabbit Monoclonal Antibody
MBS179519-01 0.03 mL

Anti-C9/Complement Component C9 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-C9/Complement Component C9 Rabbit Monoclonal Antibody
MBS179519-02 0.1 mL

Anti-C9/Complement Component C9 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-C9/Complement Component C9 Rabbit Monoclonal Antibody
MBS179519-03 5x 0.1 mL

Anti-C9/Complement Component C9 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SFRS11 Blocking Peptide
33R-4478 0.1 mg

SFRS11 Blocking Peptide

Sign In for Pricing
View Details