Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alkaline ceramidase 2 (Acer2)

This Recombinant Mouse Alkaline ceramidase 2 (Acer2) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Alkaline ceramidase 2, AlkCDase 2, Alkaline CDase 2, maCER2, EC= 3.5.1.23, Acylsphingosine deacylase 3-like, Cancer-related gene liver 1 protein

UniProt

Q8VD53

Expression Region

1-275

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAPHWWDHLRAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFILPPICMCLFRQYATCF NSGIYLIWTLLVVVGIGSVYFHATLSFLGQMLDELAILWVLMCALAMWFPRRYLPKIFRN DRGRFKAVVCVLSAITTCLAFIKPAINNISLMILGLPCTALLVAELKRCDNVRVFKLGLF SGLWWTLALFCWISDQAFCELLSSFHFPYLHCVWHILICLASYLGCVCFAYFDAASEIPE QGPVIRFWPSEKWAFIGVPYVSLLCAHKKSPVKIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Vmn1r169 shRNA (UAS) - Lentiviral mouse Vmn1r169 shRNA (UAS, GFP) (100)
GTR15173469 1 Vial

Lentiviral mouse Vmn1r169 shRNA (UAS) - Lentiviral mouse Vmn1r169 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rabbit anti Monkey IgG IgA IgM (heavy and light chains)
RAMon/Ig/7S 10 mg

Rabbit anti Monkey IgG IgA IgM (heavy and light chains)

Sign In for Pricing
View Details
DsbG protein
30R-1281 0.1 mg

DsbG protein

Sign In for Pricing
View Details
DHPR, alpha 2 (Dihydropyridine Receptor, CACNA1S) discontinued
D6500-10A 100 µL

DHPR, alpha 2 (Dihydropyridine Receptor, CACNA1S) discontinued

Sign In for Pricing
View Details
CDH-1 Antibody, HRP conjugated
CSB-PA312474YB01EUK-01 50 µg

CDH-1 Antibody, HRP conjugated

Sign In for Pricing
View Details
CDH-1 Antibody, HRP conjugated
CSB-PA312474YB01EUK-02 100 µg

CDH-1 Antibody, HRP conjugated

Sign In for Pricing
View Details