Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alkaline ceramidase 2 (Acer2)

This Recombinant Mouse Alkaline ceramidase 2 (Acer2) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Alkaline ceramidase 2, AlkCDase 2, Alkaline CDase 2, maCER2, EC= 3.5.1.23, Acylsphingosine deacylase 3-like, Cancer-related gene liver 1 protein

UniProt

Q8VD53

Expression Region

1-275

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAPHWWDHLRAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFILPPICMCLFRQYATCF NSGIYLIWTLLVVVGIGSVYFHATLSFLGQMLDELAILWVLMCALAMWFPRRYLPKIFRN DRGRFKAVVCVLSAITTCLAFIKPAINNISLMILGLPCTALLVAELKRCDNVRVFKLGLF SGLWWTLALFCWISDQAFCELLSSFHFPYLHCVWHILICLASYLGCVCFAYFDAASEIPE QGPVIRFWPSEKWAFIGVPYVSLLCAHKKSPVKIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD13
orb1132772 100 µg

Anti-CD13

Sign In for Pricing
View Details
PYRP2 Antibody
orb794920 2 mg

PYRP2 Antibody

Sign In for Pricing
View Details
Mouse Eef1e1 Pre-designed siRNA Set A
SI104087A 1 Each

Mouse Eef1e1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Factor I Antibody Blocking Peptide
orb1506011 500 µg

Factor I Antibody Blocking Peptide

Sign In for Pricing
View Details
CHADL, ID (CHADL, SLRR4B, Chondroadherin-like protein) (FITC) discontinued
033825-FITC 200 µL

CHADL, ID (CHADL, SLRR4B, Chondroadherin-like protein) (FITC) discontinued

Sign In for Pricing
View Details
ANXA1 (Annexin A1, Annexin I, Annexin-1, Calpactin II, Calpactin-2, Chromobindin-9, Lipocortin I, Phospholipase A2 Inhibitory Protein, p35, ANX1, LPC1) (MaxLight 650)
137540-ML650 100 µL

ANXA1 (Annexin A1, Annexin I, Annexin-1, Calpactin II, Calpactin-2, Chromobindin-9, Lipocortin I, Phospholipase A2 Inhibitory Protein, p35, ANX1, LPC1) (MaxLight 650)

Sign In for Pricing
View Details