Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Ustilago maydis Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q0H8X4

Expression Region

1-275

Origin

Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTQLSRTQFQFQPFHLVTPSPWPLLTSFALLILTSAAVMYFNGYANPLGGSGALLVGIG LATTVAAMALWFRDVVAEGTFLGDHTILVQKGITMGVALFIISEVFFFISVFWAFFHSSL SPTVELGAQWPPVGIATINPFELPLLNTILLLSSGATVTYAHHSVIEGNRRGAILGTLMT LIFAVLFTICQGIEYLNAGFTIADGVFGSTFFFSTGFHGVHVIIGTLFIAVAFFRMLSYH LTDHHHLGFEASILYWHFVDVVWLFLFISVYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lemd1 siRNA Oligos set (Mouse)
26433174 3x 5 nmol

Lemd1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Recombinant Human Fibronectin
OM643751-01 10 µg

Recombinant Human Fibronectin

Sign In for Pricing
View Details
Recombinant Human Fibronectin
OM643751-02 50 µg

Recombinant Human Fibronectin

Sign In for Pricing
View Details
Recombinant Human Fibronectin
OM643751-03 100 µg

Recombinant Human Fibronectin

Sign In for Pricing
View Details
Recombinant Human Fibronectin
OM643751-04 250 µg

Recombinant Human Fibronectin

Sign In for Pricing
View Details
Recombinant Mouse PLGF/PGF Protein
MBS9144052-01 0.01 mg

Recombinant Mouse PLGF/PGF Protein

Sign In for Pricing
View Details