Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Ustilago maydis Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q0H8X4

Expression Region

1-275

Origin

Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTQLSRTQFQFQPFHLVTPSPWPLLTSFALLILTSAAVMYFNGYANPLGGSGALLVGIG LATTVAAMALWFRDVVAEGTFLGDHTILVQKGITMGVALFIISEVFFFISVFWAFFHSSL SPTVELGAQWPPVGIATINPFELPLLNTILLLSSGATVTYAHHSVIEGNRRGAILGTLMT LIFAVLFTICQGIEYLNAGFTIADGVFGSTFFFSTGFHGVHVIIGTLFIAVAFFRMLSYH LTDHHHLGFEASILYWHFVDVVWLFLFISVYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Allyloxyguanosine
HY-152546 1 Each

8-Allyloxyguanosine

Sign In for Pricing
View Details
Lentiviral mouse Wnt4 shRNA (UAS) - Lentiviral mouse Wnt4 shRNA (UAS) (25)
GTR15147473 1 Vial

Lentiviral mouse Wnt4 shRNA (UAS) - Lentiviral mouse Wnt4 shRNA (UAS) (25)

Sign In for Pricing
View Details
Tissue FFPE Sections, Cartilage
CS806014 5x 5 µm

Tissue FFPE Sections, Cartilage

Sign In for Pricing
View Details
Sheep β-CG ELISA Kit
ESC0009 96 Tests

Sheep β-CG ELISA Kit

Sign In for Pricing
View Details
PRKD3 Protein Vector (Mouse) (pPB-C-His)
PV219322 500 ng

PRKD3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Human Apoptotic Peptidase Activating Factor 1 (APAF1) ELISA Kit
MBS2019454-01 24 Strip Well

Human Apoptotic Peptidase Activating Factor 1 (APAF1) ELISA Kit

Sign In for Pricing
View Details