Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Ustilago maydis Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q0H8X4

Expression Region

1-275

Origin

Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTQLSRTQFQFQPFHLVTPSPWPLLTSFALLILTSAAVMYFNGYANPLGGSGALLVGIG LATTVAAMALWFRDVVAEGTFLGDHTILVQKGITMGVALFIISEVFFFISVFWAFFHSSL SPTVELGAQWPPVGIATINPFELPLLNTILLLSSGATVTYAHHSVIEGNRRGAILGTLMT LIFAVLFTICQGIEYLNAGFTIADGVFGSTFFFSTGFHGVHVIIGTLFIAVAFFRMLSYH LTDHHHLGFEASILYWHFVDVVWLFLFISVYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Inhibin B (INHB) ELISA Kit
EKN51251 96 Tests

Human Inhibin B (INHB) ELISA Kit

Sign In for Pricing
View Details
Phospho-CSFR (Tyr723) Cell-Based ELISA Kit
CBP1258 1 Kit

Phospho-CSFR (Tyr723) Cell-Based ELISA Kit

Sign In for Pricing
View Details
FUT8 Polyclonal Antibody, Cy5.5 Conjugated
bs-6280R-Cy5.5 100 µL

FUT8 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal IFN-gamma R1/CD119 Antibody (062) [Allophycocyanin]
NBP2-90685APC 0.1 mL

Rabbit Monoclonal IFN-gamma R1/CD119 Antibody (062) [Allophycocyanin]

Sign In for Pricing
View Details
TMEM179B Human shRNA Plasmid Kit (Locus ID 374395)
TR307925 1 Kit

TMEM179B Human shRNA Plasmid Kit (Locus ID 374395)

Sign In for Pricing
View Details
Ctxn1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6842902 1.0 µg DNA

Ctxn1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details