Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oceanobacillus iheyensis Undecaprenyl-diphosphatase (uppP)

This Recombinant Oceanobacillus iheyensis Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q8CXK0

Expression Region

1-275

Origin

Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVFENFWTIVHYFVLGLVQGITEPIPISSSGHIIIFRELFGIEARGLSFEIFVNLASLL AVLIIYRKDIVRLAVNSWNFIFKQEKESKSDFMFVVYLVLATIPVGIVGVLFGDEIGAFI GEDGTTVVGITLLITAAAIWMIRNLRGRKIEGDLSTKDAVIVGLAQAVAVTPGISRSGAT LVASMLMGMKQDTALRFSFLLYIPVSLGSSILEIPNIVRDPNVQELWIPYLVAFITAFIA SYFALKWFMNIMRHGNLKYFAYYCVIVGVLVLIFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TPL2/MAP3K8/MEKK8 Protein (GST Tag)
PKSH030380 50 µg

Recombinant Human TPL2/MAP3K8/MEKK8 Protein (GST Tag)

Sign In for Pricing
View Details
Human RAR Related Orphan Receptor Alpha (RORa) ELISA Kit
RD-RORa-Hu-01 96 Tests

Human RAR Related Orphan Receptor Alpha (RORa) ELISA Kit

Sign In for Pricing
View Details
Human RAR Related Orphan Receptor Alpha (RORa) ELISA Kit
RD-RORa-Hu-02 48 Tests

Human RAR Related Orphan Receptor Alpha (RORa) ELISA Kit

Sign In for Pricing
View Details
MMP15 (NM_002428) Human Over-expression Lysate
LC400870 20 µg

MMP15 (NM_002428) Human Over-expression Lysate

Sign In for Pricing
View Details
POLR2A Mouse Monoclonal Antibody [A5F3]
HA600062 100 µL

POLR2A Mouse Monoclonal Antibody [A5F3]

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS632357 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details