Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodococcus erythropolis ATP synthase subunit a (atpB)

This Recombinant Rhodococcus erythropolis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C1A1Y4

Expression Region

1-275

Origin

Rhodococcus erythropolis (strain PR4 / NBRC 100887)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMAADRLRERTLSVTTLAADEFHAPSLDDFFPPSVLIHAGPFELDRLMLIRLLMSVLVAA FFVIAMRSPRLVPRGMQNAAELALDFVRINIAEEILGKEQGKRFLPVITTIFFIVVASNM ASIIPFLNISPNARIGMPLVLAALAYIVFNYVGIKKYGFFKYVKSSIVVPGVPLPLHFLL VPIEFISTFILRPFTLMVRLMANMLAGHILLVLFFSATNYFFFVSGGFQAIFGVPSIIAG IAFTFFELLVIFLQAYVFALLTAVYIELALHADEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bai1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
12994116 3x 1.0 µg

Bai1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Acidiphilium cryptum Triosephosphate isomerase (tpiA)
MBS1134568-01 0.05 mg (E-Coli)

Recombinant Acidiphilium cryptum Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Acidiphilium cryptum Triosephosphate isomerase (tpiA)
MBS1134568-02 0.05 mg (Yeast)

Recombinant Acidiphilium cryptum Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Acidiphilium cryptum Triosephosphate isomerase (tpiA)
MBS1134568-03 0.2 mg (E-Coli)

Recombinant Acidiphilium cryptum Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Acidiphilium cryptum Triosephosphate isomerase (tpiA)
MBS1134568-04 0.05 mg (Baculovirus)

Recombinant Acidiphilium cryptum Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Acidiphilium cryptum Triosephosphate isomerase (tpiA)
MBS1134568-05 0.5 mg (E-Coli)

Recombinant Acidiphilium cryptum Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details