Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodococcus erythropolis ATP synthase subunit a (atpB)

This Recombinant Rhodococcus erythropolis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C1A1Y4

Expression Region

1-275

Origin

Rhodococcus erythropolis (strain PR4 / NBRC 100887)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMAADRLRERTLSVTTLAADEFHAPSLDDFFPPSVLIHAGPFELDRLMLIRLLMSVLVAA FFVIAMRSPRLVPRGMQNAAELALDFVRINIAEEILGKEQGKRFLPVITTIFFIVVASNM ASIIPFLNISPNARIGMPLVLAALAYIVFNYVGIKKYGFFKYVKSSIVVPGVPLPLHFLL VPIEFISTFILRPFTLMVRLMANMLAGHILLVLFFSATNYFFFVSGGFQAIFGVPSIIAG IAFTFFELLVIFLQAYVFALLTAVYIELALHADEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pannexin 1 Antibody Western Blot Positive Control
MBS543036-01 5 Applications

Pannexin 1 Antibody Western Blot Positive Control

Sign In for Pricing
View Details
Pannexin 1 Antibody Western Blot Positive Control
MBS543036-02 5x 5 Applications

Pannexin 1 Antibody Western Blot Positive Control

Sign In for Pricing
View Details
Bis (mercaptocyclohexane) titanium tetrachloride
sc-300236A 5 g

Bis (mercaptocyclohexane) titanium tetrachloride

Sign In for Pricing
View Details
THAP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV690991 1.0 µg DNA

THAP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CD44 (Phospho-Ser706) Antibody
8A0847-AAT 50 µg

CD44 (Phospho-Ser706) Antibody

Sign In for Pricing
View Details
Recombinant Human PRR23B Protein
E30P68643A 50 µg

Recombinant Human PRR23B Protein

Sign In for Pricing
View Details