Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodococcus erythropolis ATP synthase subunit a (atpB)

This Recombinant Rhodococcus erythropolis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C1A1Y4

Expression Region

1-275

Origin

Rhodococcus erythropolis (strain PR4 / NBRC 100887)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMAADRLRERTLSVTTLAADEFHAPSLDDFFPPSVLIHAGPFELDRLMLIRLLMSVLVAA FFVIAMRSPRLVPRGMQNAAELALDFVRINIAEEILGKEQGKRFLPVITTIFFIVVASNM ASIIPFLNISPNARIGMPLVLAALAYIVFNYVGIKKYGFFKYVKSSIVVPGVPLPLHFLL VPIEFISTFILRPFTLMVRLMANMLAGHILLVLFFSATNYFFFVSGGFQAIFGVPSIIAG IAFTFFELLVIFLQAYVFALLTAVYIELALHADEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Carboxyl Ester Lipase/CEL Antibody [Alexa Fluor 700]
NBP2-98314AF700 0.1 mL

Rabbit Polyclonal Carboxyl Ester Lipase/CEL Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Zim1 Mouse Gene Knockout Kit (CRISPR)
KN520089 1 Kit

Zim1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(1R,4S) -Bicyclo[2.2.2]oct-5-ene-2,3-dicarboxylic acid
OR16060-01 500 mg

(1R,4S) -Bicyclo[2.2.2]oct-5-ene-2,3-dicarboxylic acid

Sign In for Pricing
View Details
(1R,4S) -Bicyclo[2.2.2]oct-5-ene-2,3-dicarboxylic acid
OR16060-02 1 g

(1R,4S) -Bicyclo[2.2.2]oct-5-ene-2,3-dicarboxylic acid

Sign In for Pricing
View Details
(1R,4S) -Bicyclo[2.2.2]oct-5-ene-2,3-dicarboxylic acid
OR16060-03 5 g

(1R,4S) -Bicyclo[2.2.2]oct-5-ene-2,3-dicarboxylic acid

Sign In for Pricing
View Details
(1R,4S) -Bicyclo[2.2.2]oct-5-ene-2,3-dicarboxylic acid
OR16060-04 10 g

(1R,4S) -Bicyclo[2.2.2]oct-5-ene-2,3-dicarboxylic acid

Sign In for Pricing
View Details