Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodococcus erythropolis ATP synthase subunit a (atpB)

This Recombinant Rhodococcus erythropolis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C1A1Y4

Expression Region

1-275

Origin

Rhodococcus erythropolis (strain PR4 / NBRC 100887)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMAADRLRERTLSVTTLAADEFHAPSLDDFFPPSVLIHAGPFELDRLMLIRLLMSVLVAA FFVIAMRSPRLVPRGMQNAAELALDFVRINIAEEILGKEQGKRFLPVITTIFFIVVASNM ASIIPFLNISPNARIGMPLVLAALAYIVFNYVGIKKYGFFKYVKSSIVVPGVPLPLHFLL VPIEFISTFILRPFTLMVRLMANMLAGHILLVLFFSATNYFFFVSGGFQAIFGVPSIIAG IAFTFFELLVIFLQAYVFALLTAVYIELALHADEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C1qA (Complement Component 1, Q Subcomponent A) ELISA Kit
EK243081 96 Well

Human C1qA (Complement Component 1, Q Subcomponent A) ELISA Kit

Sign In for Pricing
View Details
CENPA (Histone H3-like Centromeric Protein A, Centromere Autoantigen A, Centromere Protein A, CENP-A) (PE)
124842-PE 100 µL

CENPA (Histone H3-like Centromeric Protein A, Centromere Autoantigen A, Centromere Protein A, CENP-A) (PE)

Sign In for Pricing
View Details
Mouse Monoclonal DNMT1 Antibody (DNMT1/2061) [Biotin]
NBP3-08482B 100 µL

Mouse Monoclonal DNMT1 Antibody (DNMT1/2061) [Biotin]

Sign In for Pricing
View Details
UCP1/3 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61899R-BF750 100 µL

UCP1/3 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal ATP6V1B2 Antibody (OTI1E11) [Allophycocyanin]
NBP2-70238APC 0.1 mL

Mouse Monoclonal ATP6V1B2 Antibody (OTI1E11) [Allophycocyanin]

Sign In for Pricing
View Details
EFO1 siRNA (m)
sc-62258 10 µM

EFO1 siRNA (m)

Sign In for Pricing
View Details