Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodococcus erythropolis ATP synthase subunit a (atpB)

This Recombinant Rhodococcus erythropolis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C1A1Y4

Expression Region

1-275

Origin

Rhodococcus erythropolis (strain PR4 / NBRC 100887)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMAADRLRERTLSVTTLAADEFHAPSLDDFFPPSVLIHAGPFELDRLMLIRLLMSVLVAA FFVIAMRSPRLVPRGMQNAAELALDFVRINIAEEILGKEQGKRFLPVITTIFFIVVASNM ASIIPFLNISPNARIGMPLVLAALAYIVFNYVGIKKYGFFKYVKSSIVVPGVPLPLHFLL VPIEFISTFILRPFTLMVRLMANMLAGHILLVLFFSATNYFFFVSGGFQAIFGVPSIIAG IAFTFFELLVIFLQAYVFALLTAVYIELALHADEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Desmin, clone D33 Antibody
orb1087964 7 mL

Mouse Desmin, clone D33 Antibody

Sign In for Pricing
View Details
LIMD1 AAV siRNA Pooled Vector
26538161 1.0 µg

LIMD1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Thyroid Transcription Factor 1 Rabbit Monoclonal Antibody
E10G22133 100 µL

Thyroid Transcription Factor 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Borreliella burgdorferi ospA Antibody
orb3152062-01 50 µg

Borreliella burgdorferi ospA Antibody

Sign In for Pricing
View Details
Borreliella burgdorferi ospA Antibody
orb3152062-02 100 µg

Borreliella burgdorferi ospA Antibody

Sign In for Pricing
View Details
Borreliella burgdorferi ospA Antibody
orb3152062-03 1 mg

Borreliella burgdorferi ospA Antibody

Sign In for Pricing
View Details