Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodococcus erythropolis ATP synthase subunit a (atpB)

This Recombinant Rhodococcus erythropolis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C1A1Y4

Expression Region

1-275

Origin

Rhodococcus erythropolis (strain PR4 / NBRC 100887)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMAADRLRERTLSVTTLAADEFHAPSLDDFFPPSVLIHAGPFELDRLMLIRLLMSVLVAA FFVIAMRSPRLVPRGMQNAAELALDFVRINIAEEILGKEQGKRFLPVITTIFFIVVASNM ASIIPFLNISPNARIGMPLVLAALAYIVFNYVGIKKYGFFKYVKSSIVVPGVPLPLHFLL VPIEFISTFILRPFTLMVRLMANMLAGHILLVLFFSATNYFFFVSGGFQAIFGVPSIIAG IAFTFFELLVIFLQAYVFALLTAVYIELALHADEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Serpin A3/alpha 1-Antichymotrypsin Antibody (011) [Alexa Fluor 488]
NBP2-89405AF488 0.1 mL

Rabbit Monoclonal Serpin A3/alpha 1-Antichymotrypsin Antibody (011) [Alexa Fluor 488]

Sign In for Pricing
View Details
ZNF205 (NM_001042428) Human Recombinant Protein
TP301174L 1 mg

ZNF205 (NM_001042428) Human Recombinant Protein

Sign In for Pricing
View Details
CASQ1 (Calsequestrin-1, Calmitin, Calsequestrin, Skeletal Muscle Isoform, CASQ) (MaxLight 650)
MBS6221261-01 0.1 mL

CASQ1 (Calsequestrin-1, Calmitin, Calsequestrin, Skeletal Muscle Isoform, CASQ) (MaxLight 650)

Sign In for Pricing
View Details
CASQ1 (Calsequestrin-1, Calmitin, Calsequestrin, Skeletal Muscle Isoform, CASQ) (MaxLight 650)
MBS6221261-02 5x 0.1 mL

CASQ1 (Calsequestrin-1, Calmitin, Calsequestrin, Skeletal Muscle Isoform, CASQ) (MaxLight 650)

Sign In for Pricing
View Details
GTP 100mM Sodium Solution, GMP grade
GMP-GTP001-100 100 mL

GTP 100mM Sodium Solution, GMP grade

Sign In for Pricing
View Details
Rb (Phospho-Ser795) Antibody
MBS9408446-01 0.05 mL

Rb (Phospho-Ser795) Antibody

Sign In for Pricing
View Details