Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium vanbaalenii Undecaprenyl-diphosphatase (uppP)

This Recombinant Mycobacterium vanbaalenii Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A1TAS8

Expression Region

1-276

Origin

Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWLQVVVLSVLQGLTEFLPVSSSGHLAIASRVFFEDDAGASFTAVSQLGTEVAVLVYFA RDIVRIVKAWFAGLFRAGQRSADYWLGWWVIIGTIPISVVGLLFKDEIRTGARNLWLVAT AMIVFSFVIAAAEYYGRQARRVEQLTWRDSIIVGLAQCLALVPGVSRSGATISAGLFLGM HRELAARFGFLLAIPAVFASGLFSLPDAFEPVGEGMSASGAQLFVSIVIAFVVGYAAVAW FLRFLVRHSMYWFVGYRIVLGTVVLVLLSAGVVSAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fcgr2b Mouse Recombinant Protein
TP726882 10 µg

Fcgr2b Mouse Recombinant Protein

Sign In for Pricing
View Details
CFC1 Rabbit Polyclonal Antibody (BF350)
orb2520467 100 µL

CFC1 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Rabbit CXC-chemokine ligand 16 ELISA Kit
MBS728771-01 48 Well

Rabbit CXC-chemokine ligand 16 ELISA Kit

Sign In for Pricing
View Details
Rabbit CXC-chemokine ligand 16 ELISA Kit
MBS728771-02 96 Well

Rabbit CXC-chemokine ligand 16 ELISA Kit

Sign In for Pricing
View Details
Rabbit CXC-chemokine ligand 16 ELISA Kit
MBS728771-03 5x 96 Well

Rabbit CXC-chemokine ligand 16 ELISA Kit

Sign In for Pricing
View Details
Rabbit CXC-chemokine ligand 16 ELISA Kit
MBS728771-04 10x 96 Well

Rabbit CXC-chemokine ligand 16 ELISA Kit

Sign In for Pricing
View Details