Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium vanbaalenii Undecaprenyl-diphosphatase (uppP)

This Recombinant Mycobacterium vanbaalenii Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A1TAS8

Expression Region

1-276

Origin

Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWLQVVVLSVLQGLTEFLPVSSSGHLAIASRVFFEDDAGASFTAVSQLGTEVAVLVYFA RDIVRIVKAWFAGLFRAGQRSADYWLGWWVIIGTIPISVVGLLFKDEIRTGARNLWLVAT AMIVFSFVIAAAEYYGRQARRVEQLTWRDSIIVGLAQCLALVPGVSRSGATISAGLFLGM HRELAARFGFLLAIPAVFASGLFSLPDAFEPVGEGMSASGAQLFVSIVIAFVVGYAAVAW FLRFLVRHSMYWFVGYRIVLGTVVLVLLSAGVVSAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chlorobaculum parvum Lysine--tRNA ligase (lysS), partial
MBS1170236 Inquire

Recombinant Chlorobaculum parvum Lysine--tRNA ligase (lysS), partial

Sign In for Pricing
View Details
HuR shRNA (r) Lentiviral Particles
sc-270446-V 200 µL

HuR shRNA (r) Lentiviral Particles

Sign In for Pricing
View Details
USP10 CytoSection
TS400835P5 25 Slides

USP10 CytoSection

Sign In for Pricing
View Details
ATP1B2, ID (ATP1B2, Sodium/potassium-transporting ATPase subunit beta-2, Sodium/potassium-dependent ATPase subunit beta-2) (Biotin) discontinued
032271-Biotin 200 µL

ATP1B2, ID (ATP1B2, Sodium/potassium-transporting ATPase subunit beta-2, Sodium/potassium-dependent ATPase subunit beta-2) (Biotin) discontinued

Sign In for Pricing
View Details
MGAT4C Antibody (C-term)
orb30642-01 50 µL

MGAT4C Antibody (C-term)

Sign In for Pricing
View Details
MGAT4C Antibody (C-term)
orb30642-02 100 µL

MGAT4C Antibody (C-term)

Sign In for Pricing
View Details