Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinobacillus pleuropneumoniae serotype 5b UPF0761 membrane protein APL_1950 (APL_1950)

This Recombinant Actinobacillus pleuropneumoniae serotype 5b UPF0761 membrane protein APL_1950 (APL_1950) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

UPF0761 membrane protein APL_1950

UniProt

A3N3P2

Expression Region

1-276

Origin

Actinobacillus pleuropneumoniae serotype 5b (strain L20)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLSQPLFIKLLLKHWKIHNIPVSAGYLTYSTTLAIVPLVMVVFSIFTAFPIFQEATEQL KTLIYDNFAPNAGDMVEEYIDLFVANSKKMGIVSTIGLVVVALMLIQSIDETLNKMWRNH RKRSIFISFLLYAVILFIAPLLAGGSIAISSYIFSMAIFNENGLLSFSQQLLQYTPFLLI WLLFTTVYWLVPNTKVNILHAMLGAIVAAIFFTLGKQAFVWYISTFPSYQAIYGALAVLP IMLLWIHLSWQVVLFGGLITSTLNVYNEMKKGKLNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
BNC882216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-100 1x 100 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-500 1x 500 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-100 1x 100 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NTR/912), CF405S conjugate, 0.1mg/mL
BNC040912-500 1x 500 µL

NGFR (Nerve Growth Factor Receptor) (NTR/912), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details