Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinobacillus pleuropneumoniae serotype 5b UPF0761 membrane protein APL_1950 (APL_1950)

This Recombinant Actinobacillus pleuropneumoniae serotype 5b UPF0761 membrane protein APL_1950 (APL_1950) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

UPF0761 membrane protein APL_1950

UniProt

A3N3P2

Expression Region

1-276

Origin

Actinobacillus pleuropneumoniae serotype 5b (strain L20)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLSQPLFIKLLLKHWKIHNIPVSAGYLTYSTTLAIVPLVMVVFSIFTAFPIFQEATEQL KTLIYDNFAPNAGDMVEEYIDLFVANSKKMGIVSTIGLVVVALMLIQSIDETLNKMWRNH RKRSIFISFLLYAVILFIAPLLAGGSIAISSYIFSMAIFNENGLLSFSQQLLQYTPFLLI WLLFTTVYWLVPNTKVNILHAMLGAIVAAIFFTLGKQAFVWYISTFPSYQAIYGALAVLP IMLLWIHLSWQVVLFGGLITSTLNVYNEMKKGKLNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM7A3 3'UTR Lenti-reporter-Luc Vector
57329081 1.0 µg

FAM7A3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
EPHX2 antibody
70R-17118 50 μL

EPHX2 antibody

Sign In for Pricing
View Details
Canine Chitinase domain-containing protein 1 (CHID1) ELISA Kit
MBS7243859-01 48 Well

Canine Chitinase domain-containing protein 1 (CHID1) ELISA Kit

Sign In for Pricing
View Details
Canine Chitinase domain-containing protein 1 (CHID1) ELISA Kit
MBS7243859-02 96 Well

Canine Chitinase domain-containing protein 1 (CHID1) ELISA Kit

Sign In for Pricing
View Details
Canine Chitinase domain-containing protein 1 (CHID1) ELISA Kit
MBS7243859-03 5x 96 Well

Canine Chitinase domain-containing protein 1 (CHID1) ELISA Kit

Sign In for Pricing
View Details
Canine Chitinase domain-containing protein 1 (CHID1) ELISA Kit
MBS7243859-04 10x 96 Well

Canine Chitinase domain-containing protein 1 (CHID1) ELISA Kit

Sign In for Pricing
View Details