Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas mendocina Undecaprenyl-diphosphatase (uppP)

This Recombinant Pseudomonas mendocina Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A4XUB9

Expression Region

1-276

Origin

Pseudomonas mendocina (strain ymp)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIWMAFQALILGIVEGLTEFLPISSTGHLIVVGDLLGFNGETATAFKIIIQLGAILAVM WEFRARVLGVVLGLRSEPRAQRFTFNLLLAFIPAVVFGLAFADLIEHWLFNPITVATALI VGGIIMLWAEKREHAIQAESVDDMTWKLALKVGFAQCLALIPGTSRSGATIIGGLVFGLS RKAATEFSFFLAMPTMIAATVYSLFKYRDILQWSDLPIFAIGFVSTFIVAMITVRALLKF IANHSYAVFAWYRIAFGLVILATWQLHLIDWSTAQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem176a Mouse Gene Knockout Kit (CRISPR)
KN517760 1 Kit

Tmem176a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ethyl Isodehydroacetate
TRC-E921350-25G 25 g

Ethyl Isodehydroacetate

Sign In for Pricing
View Details
APRT (NM_001030018) Human Over-expression Lysate
LY422236 100 µg

APRT (NM_001030018) Human Over-expression Lysate

Sign In for Pricing
View Details
AVD Rabbit Polyclonal Antibody
TA396971S 25 µL

AVD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Potassium Vinyltrifluoroborate
TRC-P698700-2.5G 2.5 g

Potassium Vinyltrifluoroborate

Sign In for Pricing
View Details
Recombinant Human IL-1A/IL-1α Protein
PKSH033458-01 20 µg

Recombinant Human IL-1A/IL-1α Protein

Sign In for Pricing
View Details