Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas mendocina Undecaprenyl-diphosphatase (uppP)

This Recombinant Pseudomonas mendocina Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A4XUB9

Expression Region

1-276

Origin

Pseudomonas mendocina (strain ymp)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIWMAFQALILGIVEGLTEFLPISSTGHLIVVGDLLGFNGETATAFKIIIQLGAILAVM WEFRARVLGVVLGLRSEPRAQRFTFNLLLAFIPAVVFGLAFADLIEHWLFNPITVATALI VGGIIMLWAEKREHAIQAESVDDMTWKLALKVGFAQCLALIPGTSRSGATIIGGLVFGLS RKAATEFSFFLAMPTMIAATVYSLFKYRDILQWSDLPIFAIGFVSTFIVAMITVRALLKF IANHSYAVFAWYRIAFGLVILATWQLHLIDWSTAQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Human CD123 Antibody[HI12H7]
E-AB-F1340C-01 20 Tests

FITC Anti-Human CD123 Antibody[HI12H7]

Sign In for Pricing
View Details
FITC Anti-Human CD123 Antibody[HI12H7]
E-AB-F1340C-02 100 Tests

FITC Anti-Human CD123 Antibody[HI12H7]

Sign In for Pricing
View Details
FITC Anti-Human CD123 Antibody[HI12H7]
E-AB-F1340C-03 2x 100 Tests

FITC Anti-Human CD123 Antibody[HI12H7]

Sign In for Pricing
View Details
CDK6 Rabbit Polyclonal Antibody
AP08102PU-N 100 µL

CDK6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BUB1B-PAK6 (NM_001128629) Human Over-expression Lysate
LC426986 20 µg

BUB1B-PAK6 (NM_001128629) Human Over-expression Lysate

Sign In for Pricing
View Details
Ethyl 5-phenyloxazole-2-carboxylate
TRC-E938795-25MG 25 mg

Ethyl 5-phenyloxazole-2-carboxylate

Sign In for Pricing
View Details