Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus amyloliquefaciens Undecaprenyl-diphosphatase (uppP)

This Recombinant Bacillus amyloliquefaciens Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A7Z830

Expression Region

1-276

Origin

Bacillus amyloliquefaciens (strain FZB42)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLWEMFTAAVLGIVEGLTEYAPVSSTGHMIIADDIWLKSGSLMNPEAANSFKVVIQLGS ILAVAIVFKDRILHLLGLKKNVTRDQQKGYRLTIAQIAVGLVPAAVLGFLFEDFIDRYLF SVRTVAYGLIAGAVLMLIADWINKRKETIDTVDRITYKQAFCVGLFQCLALWPGFSRSGS TIAGGVIVGLNHRAAADFTFIMAIPIMAGASLLKLVKYWSSLSYDMIPFFLVGFICAFVV ALLVVKFFLRLINRIKLVPFAIYRVILGIILIMLVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FFPE Tissue Blocks, Lung
CB701334 1 Block

FFPE Tissue Blocks, Lung

Sign In for Pricing
View Details
Lentiviral mouse Dnajc25 shRNA (UAS) - Lentiviral mouse Dnajc25 shRNA (UAS, RFP) (25)
GTR15174011 1 Vial

Lentiviral mouse Dnajc25 shRNA (UAS) - Lentiviral mouse Dnajc25 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
HSD11B1L Antibody
OACA05195-100UG 100 µg

HSD11B1L Antibody

Sign In for Pricing
View Details
HSPA1A (Y525) (Heat Shock 70kD Protein 1A/1B, Heat Shock 70kD Protein 1/2, HSP70.1/HSP70.2, HSP70-1/HSP70-2, HSPA1, HSPA1B) (MaxLight 750)
MBS6479782-01 0.1 mL

HSPA1A (Y525) (Heat Shock 70kD Protein 1A/1B, Heat Shock 70kD Protein 1/2, HSP70.1/HSP70.2, HSP70-1/HSP70-2, HSPA1, HSPA1B) (MaxLight 750)

Sign In for Pricing
View Details
HSPA1A (Y525) (Heat Shock 70kD Protein 1A/1B, Heat Shock 70kD Protein 1/2, HSP70.1/HSP70.2, HSP70-1/HSP70-2, HSPA1, HSPA1B) (MaxLight 750)
MBS6479782-02 5x 0.1 mL

HSPA1A (Y525) (Heat Shock 70kD Protein 1A/1B, Heat Shock 70kD Protein 1/2, HSP70.1/HSP70.2, HSP70-1/HSP70-2, HSPA1, HSPA1B) (MaxLight 750)

Sign In for Pricing
View Details
AES 3'UTR Lenti-reporter-Luc Vector
11463081 1.0 µg

AES 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details