Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermococcus onnurineus Digeranylgeranylglyceryl phosphate synthase (TON_1950)

This Recombinant Thermococcus onnurineus Digeranylgeranylglyceryl phosphate synthase (TON_1950) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

B6YW76

Expression Region

1-276

Origin

Thermococcus onnurineus (strain NA1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELKAFIEITRPHNCILAGIVGLLGSIVALGHFPDPKTALLIFLVVTVGCAGGNTINDYF DYEIDKINRPERPLPRGAMGRKVALYYSMLLFAVGLALAYMINIYAFILGVIAYVTMFIY AWKLKPLPFVGNIVVAGLTGATPLYGAVAVEHLGLAGYLAICAFLVNVAREVIKDIEDVE GDMAKGAKTLPIIWGKKRAAYVGVLFALLTVIASFLPVKASVGVGYYAMVPVDLLILYAA YLILRNQDREVAHKSQKLLKMSIFLAVMAFLIAAIV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Htra2 shRNA (UAS) - Lentiviral mouse Htra2 shRNA (UAS, GFP) (100)
GTR15261921 1 Vial

Lentiviral mouse Htra2 shRNA (UAS) - Lentiviral mouse Htra2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR561483 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Mouse Monoclonal OXNAD1 Antibody (OTI1D1) [PerCP]
NBP2-73175PCP 0.1 mL

Mouse Monoclonal OXNAD1 Antibody (OTI1D1) [PerCP]

Sign In for Pricing
View Details
Cyclin A1/A2 Rabbit Monoclonal Antibody
E46F1382 40 µL

Cyclin A1/A2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NPS Rabbit Polyclonal Antibody
BT-AP03859-01 20 µL

NPS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NPS Rabbit Polyclonal Antibody
BT-AP03859-02 50 µL

NPS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details