Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cupriavidus pinatubonensis Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Cupriavidus pinatubonensis Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q475B0

Expression Region

1-276

Origin

Cupriavidus pinatubonensis (strain JMP134 / LMG 1197) (Alcaligenes eutrophus) (Ralstonia eutropha)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIHPQFDPVAIHIGPLAIRWYGLMYLAGFIMFLWFGRLRIRQPHMAARGWAARDLDDML FFGVMGVILGGRLGYVLFYKPSYYLTHPLEIFKVWEGGMAFHGGFLGVLVAMWLFARLRQ RHWLEVTDFIAPMIPCGLAAGRIGNFINGELWGRPTDLPWGMIFPQAGDNIPRHPSQLYQ FAGEGVALFIILWLFARKPRPMGAVSGVFLIGYGGFRFAAEFAREPDSFLGLLAMHLSMG QWLSLPMILIGIAMVVWAYRRQARSGEERPVTDSGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-500 1x 500 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-100 1x 100 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-500 1x 500 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF740 conjugate, 0.1mg/mL
BNC740245-500 1x 500 µL

SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details