Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella sonnei Ferrous iron permease EfeU (efeU)

This Recombinant Shigella sonnei Ferrous iron permease EfeU (efeU) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Ferrous iron permease EfeU, Fe (2+) ion permease EfeU, Ferrous iron uptake protein

UniProt

Q3Z398

Expression Region

1-276

Origin

Shigella sonnei (strain Ss046)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVPFLIMLREGLEAALIVSLIASYLKRTQRGRWIGVMWIGVLLAAALCLGLGIFINETT GEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQLEQAVDSALQRGNHHGWALV MMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAMLGLATAVVLGFLLYWGGIRLNLGAF FKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSAVLSTHSLFGTLMEGIFGYQ EAPSVSEVAVWFIYLIPALVAFALPPRAGATASRSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF640R conjugate, 0.1mg/mL
BNC401993-500 1x 500 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tiglyl Glycine
TRC-T440100-50MG 50 mg

Tiglyl Glycine

Sign In for Pricing
View Details
Crude Erythrina cristagalli Lectin (Coral Tree) -ECA-
L-5900-100 100 mg

Crude Erythrina cristagalli Lectin (Coral Tree) -ECA-

Sign In for Pricing
View Details
SPATC1 (NM_001134374) Human Over-expression Lysate
LY427404 100 µg

SPATC1 (NM_001134374) Human Over-expression Lysate

Sign In for Pricing
View Details
Factor H (CFH) Human Gene Knockout Kit (CRISPR)
KN220707BN 1 Kit

Factor H (CFH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Col11a2 activation kit by CRISPRa
GA200804 1 Kit

Mouse Col11a2 activation kit by CRISPRa

Sign In for Pricing
View Details