Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella sonnei Ferrous iron permease EfeU (efeU)

This Recombinant Shigella sonnei Ferrous iron permease EfeU (efeU) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Ferrous iron permease EfeU, Fe (2+) ion permease EfeU, Ferrous iron uptake protein

UniProt

Q3Z398

Expression Region

1-276

Origin

Shigella sonnei (strain Ss046)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVPFLIMLREGLEAALIVSLIASYLKRTQRGRWIGVMWIGVLLAAALCLGLGIFINETT GEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQLEQAVDSALQRGNHHGWALV MMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAMLGLATAVVLGFLLYWGGIRLNLGAF FKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSAVLSTHSLFGTLMEGIFGYQ EAPSVSEVAVWFIYLIPALVAFALPPRAGATASRSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF594 conjugate, 0.1mg/mL
BNC942207-100 1x 100 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
cPLA2 beta (PLA2G4B) Rabbit Polyclonal Antibody
AP06422PU-N 100 µg

cPLA2 beta (PLA2G4B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LAMTOR1 Antibody
KC-45976-01 50 μL

LAMTOR1 Antibody

Sign In for Pricing
View Details
LAMTOR1 Antibody
KC-45976-02 100 µL

LAMTOR1 Antibody

Sign In for Pricing
View Details
LAMTOR1 Antibody
KC-45976-03 1 mL

LAMTOR1 Antibody

Sign In for Pricing
View Details
Zdhhc24 Mouse Gene Knockout Kit (CRISPR)
KN519689 1 Kit

Zdhhc24 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details