Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ferrous iron permease EfeU (efeU)

This Recombinant Ferrous iron permease EfeU (efeU) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Ferrous iron permease EfeU, Fe (2+) ion permease EfeU, Ferrous iron uptake protein

UniProt

Q8FJ36

Expression Region

1-276

Origin

Escherichia coli O6

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVPFLIILREGLEAALIVSLIASYLTRTQRGRWIGVMWIGVLLAAALCLGLGIFINETT GEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQLEQAVDSALQRGNHHGWALV MMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAMLGLATAVVLGFLLYWGGIRLNLGAF FKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSAVLSTHSLFGTLMEGIFGYQ EAPSVSEVAVWFIYLIPALVAFVLPPRAGATASRSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR gamma (Nuclear Receptor ROR-gamma, Nuclear Receptor RZR-gamma, Nuclear Receptor Subfamily 1 group F Member 3, Retinoid-Related orphan Receptor-gamma, RORC, NR1F3, RORG, RZRG) discontinued
225579-01 50 µL

ROR gamma (Nuclear Receptor ROR-gamma, Nuclear Receptor RZR-gamma, Nuclear Receptor Subfamily 1 group F Member 3, Retinoid-Related orphan Receptor-gamma, RORC, NR1F3, RORG, RZRG) discontinued

Sign In for Pricing
View Details
ROR gamma (Nuclear Receptor ROR-gamma, Nuclear Receptor RZR-gamma, Nuclear Receptor Subfamily 1 group F Member 3, Retinoid-Related orphan Receptor-gamma, RORC, NR1F3, RORG, RZRG) discontinued
225579-02 100 µL

ROR gamma (Nuclear Receptor ROR-gamma, Nuclear Receptor RZR-gamma, Nuclear Receptor Subfamily 1 group F Member 3, Retinoid-Related orphan Receptor-gamma, RORC, NR1F3, RORG, RZRG) discontinued

Sign In for Pricing
View Details
Human Myosin Heavy Chain 8 Skeletal Muscle Perinatal ELISA Kit
IHUMYH8KT 1 Each

Human Myosin Heavy Chain 8 Skeletal Muscle Perinatal ELISA Kit

Sign In for Pricing
View Details
H-Phe-NH₂
4001235.0005 5 g

H-Phe-NH₂

Sign In for Pricing
View Details
EIF4B (S422) (Eukaryotic Initiation Factor 4B, Eukaryotic Translation Initiation Factor 4B, hCG_2014609, eIF4B) (AP) discontinued
E8949-39J-AP 200 µL

EIF4B (S422) (Eukaryotic Initiation Factor 4B, Eukaryotic Translation Initiation Factor 4B, hCG_2014609, eIF4B) (AP) discontinued

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Alpha-Fetoprotein (aFP)
MBS2038936-01 0.1 mL

PE-Linked Polyclonal Antibody to Alpha-Fetoprotein (aFP)

Sign In for Pricing
View Details