Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ferrous iron permease EfeU (efeU)

This Recombinant Ferrous iron permease EfeU (efeU) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Ferrous iron permease EfeU, Fe (2+) ion permease EfeU, Ferrous iron uptake protein

UniProt

Q8FJ36

Expression Region

1-276

Origin

Escherichia coli O6

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVPFLIILREGLEAALIVSLIASYLTRTQRGRWIGVMWIGVLLAAALCLGLGIFINETT GEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQLEQAVDSALQRGNHHGWALV MMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAMLGLATAVVLGFLLYWGGIRLNLGAF FKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSAVLSTHSLFGTLMEGIFGYQ EAPSVSEVAVWFIYLIPALVAFVLPPRAGATASRSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human DHCR24 sgRNA gene knockout kit - Lentiviral human DHCR24 sgRNA gene knockout kit (25)
GTR15392799 1 Vial

Lentiviral human DHCR24 sgRNA gene knockout kit - Lentiviral human DHCR24 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Lentiviral mouse Glod4 shRNA (UAS) - Lentiviral mouseGlod4 shRNA (UAS, GFP) (25)
GTR15211880 1 Vial

Lentiviral mouse Glod4 shRNA (UAS) - Lentiviral mouseGlod4 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
RAGE, CT (Receptor for Advanced Glycosylation End Products) (MaxLight 750)
MBS6453399-01 0.1 mL

RAGE, CT (Receptor for Advanced Glycosylation End Products) (MaxLight 750)

Sign In for Pricing
View Details
RAGE, CT (Receptor for Advanced Glycosylation End Products) (MaxLight 750)
MBS6453399-02 5x 0.1 mL

RAGE, CT (Receptor for Advanced Glycosylation End Products) (MaxLight 750)

Sign In for Pricing
View Details
CKS2 (CDC28 Protein Kinase Regulatory Subunit 2, CKSHS2) (MaxLight 490)
244724-ML490 100 µL

CKS2 (CDC28 Protein Kinase Regulatory Subunit 2, CKSHS2) (MaxLight 490)

Sign In for Pricing
View Details
2310039D24Rik 3'UTR GFP Stable Cell Line
TU150434 1.0 mL

2310039D24Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details