Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ferrous iron permease EfeU (efeU)

This Recombinant Ferrous iron permease EfeU (efeU) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Ferrous iron permease EfeU, Fe (2+) ion permease EfeU, Ferrous iron uptake protein

UniProt

Q8XAS8

Expression Region

1-276

Origin

Escherichia coli O157:H7

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVPFLIMLREGLEAALIVSLIASYLKRTQRGRWIGVMWIGVLLAAALCLGLGIFINETT GEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQLEQAVDSALQRGNHHGWALV MMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAMLGLATAVVLGFLLYWGGIRLNLGAF FKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSAVLSTHSLFGTLMEGIFGYQ EAPSVSEVAVWFIYLIPALVAFALPPRAGATASRSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRLF3 CRISPR Activation Plasmid (m2)
sc-424857-ACT-2 20 µg

CRLF3 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
hnRNP H Lentiviral Activation Particles (m2)
sc-425559-LAC-2 200 µL

hnRNP H Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Arfgap1 sgRNA CRISPR Lentivector set (Rat)
K7410801 3x 1.0 µg

Arfgap1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
MIR5197 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV733243 1.0 µg DNA

MIR5197 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
GMFB antibody
OAGA00938-100UL 100 µL

GMFB antibody

Sign In for Pricing
View Details
FIBP CRISPRa sgRNA lentivector (set of three targets)(Human)
20554121 3x 1.0µg DNA

FIBP CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details