Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ferrous iron permease EfeU (efeU)

This Recombinant Ferrous iron permease EfeU (efeU) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Ferrous iron permease EfeU, Fe (2+) ion permease EfeU, Ferrous iron uptake protein

UniProt

Q8XAS8

Expression Region

1-276

Origin

Escherichia coli O157:H7

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVPFLIMLREGLEAALIVSLIASYLKRTQRGRWIGVMWIGVLLAAALCLGLGIFINETT GEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQLEQAVDSALQRGNHHGWALV MMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAMLGLATAVVLGFLLYWGGIRLNLGAF FKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSAVLSTHSLFGTLMEGIFGYQ EAPSVSEVAVWFIYLIPALVAFALPPRAGATASRSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf44 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0291106 1.0 µg DNA

C12orf44 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human Thyroid Peroxidase (TPO) ELISA Kit
EKL62621 96 Tests

Human Thyroid Peroxidase (TPO) ELISA Kit

Sign In for Pricing
View Details
FLAG peptide
BUP05635-01 5 mg

FLAG peptide

Sign In for Pricing
View Details
FLAG peptide
BUP05635-02 10 mg

FLAG peptide

Sign In for Pricing
View Details
FLAG peptide
BUP05635-03 25 mg

FLAG peptide

Sign In for Pricing
View Details
FLAG peptide
BUP05635-04 50 mg

FLAG peptide

Sign In for Pricing
View Details