Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Putative inactive ferrous iron permease EfeU (efeU)

This Recombinant Escherichia coli Putative inactive ferrous iron permease EfeU (efeU) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Putative inactive ferrous iron permease EfeU, Putative Fe (2+) ion permease EfeU

UniProt

P75901

Expression Region

1-276

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVPFLIMLREGLEAALIVSLIASYLKRTQRGMXDCVMWIGVLLAAALCLGLGIFINETT GEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQLEQAVDSALQRGNHHGWALV MMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAMLGLATAVVLGFLLYWGGIRLNLGAF FKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSAVLSTHSLFGTLMEGIFGYQ EAPSVSEVAVWFIYLIPALVAFALPPRAGATASRSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Allograft Inflammatory Factor 1 (AIF1) Antibody (Biotin)
abx319638-01 20 µg

Allograft Inflammatory Factor 1 (AIF1) Antibody (Biotin)

Sign In for Pricing
View Details
Allograft Inflammatory Factor 1 (AIF1) Antibody (Biotin)
abx319638-02 50 µg

Allograft Inflammatory Factor 1 (AIF1) Antibody (Biotin)

Sign In for Pricing
View Details
Allograft Inflammatory Factor 1 (AIF1) Antibody (Biotin)
abx319638-03 100 µg

Allograft Inflammatory Factor 1 (AIF1) Antibody (Biotin)

Sign In for Pricing
View Details
Allograft Inflammatory Factor 1 (AIF1) Antibody (Biotin)
abx319638-04 200 µg

Allograft Inflammatory Factor 1 (AIF1) Antibody (Biotin)

Sign In for Pricing
View Details
Allograft Inflammatory Factor 1 (AIF1) Antibody (Biotin)
abx319638-05 1 mg

Allograft Inflammatory Factor 1 (AIF1) Antibody (Biotin)

Sign In for Pricing
View Details
Rat Gabrr1 ELISA Kit
ELI-08154r 96 Tests

Rat Gabrr1 ELISA Kit

Sign In for Pricing
View Details