Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Undecaprenyl-diphosphatase (uppP)

This Recombinant Bacillus subtilis Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

P94507

Expression Region

1-276

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLWELFVAAILGIVEGLTEYAPVSSTGHMIIVDDIWLKSSNLMSEEAANSFKVVIQLGS ILAVAIVFKDRILNLLGLKKNITSDQEQGHKLSIAQIAVGLVPAAVLGFLFEDYIDEYLF SVKTVAIGLIAGAILMLFADWVNKRKTATDTLDRISYKQAIAVGLFQCLSLWPGFSRSGS TISGGVILGLNHRAAADFTFIMAMPIMMGASFLSLVKHWDSLSSDLMPFFIVGFICAFVV ALFVVRFFLRLINKIKLVPFAIYRIILGVILLLIMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TTC38 Antibody Picoband® (Dylight488 Conjugate)
A16794-1-Dylight488 100 µg

Anti-TTC38 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
EPS15R, NT (Epidermal Growth Factor Receptor Substrate 15-like 1, Eps15-related Protein, EPS15L1) (FITC) discontinued
E3376-05A-FITC 200 µL

EPS15R, NT (Epidermal Growth Factor Receptor Substrate 15-like 1, Eps15-related Protein, EPS15L1) (FITC) discontinued

Sign In for Pricing
View Details
FITC-Labeled HER2/CD340, Human (HEK293, His)
HY-P78652-01 25 µg

FITC-Labeled HER2/CD340, Human (HEK293, His)

Sign In for Pricing
View Details
FITC-Labeled HER2/CD340, Human (HEK293, His)
HY-P78652-02 200 µg

FITC-Labeled HER2/CD340, Human (HEK293, His)

Sign In for Pricing
View Details
Human VIM Protein Lysate
MBS8429695-01 0.02 mg

Human VIM Protein Lysate

Sign In for Pricing
View Details
Human VIM Protein Lysate
MBS8429695-02 5x 0.02 mg

Human VIM Protein Lysate

Sign In for Pricing
View Details