Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Undecaprenyl-diphosphatase (uppP)

This Recombinant Bacillus subtilis Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

P94507

Expression Region

1-276

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLWELFVAAILGIVEGLTEYAPVSSTGHMIIVDDIWLKSSNLMSEEAANSFKVVIQLGS ILAVAIVFKDRILNLLGLKKNITSDQEQGHKLSIAQIAVGLVPAAVLGFLFEDYIDEYLF SVKTVAIGLIAGAILMLFADWVNKRKTATDTLDRISYKQAIAVGLFQCLSLWPGFSRSGS TISGGVILGLNHRAAADFTFIMAMPIMMGASFLSLVKHWDSLSSDLMPFFIVGFICAFVV ALFVVRFFLRLINKIKLVPFAIYRIILGVILLLIMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFP Antibody
MBS5317345-01 0.05 mL

GFP Antibody

Sign In for Pricing
View Details
GFP Antibody
MBS5317345-02 5x 0.05 mL

GFP Antibody

Sign In for Pricing
View Details
Rat Anti-Mouse IgD mAb (APC)
orb2709829 100 Tests

Rat Anti-Mouse IgD mAb (APC)

Sign In for Pricing
View Details
Lentiviral human FHL5 sgRNA gene knockout kit - Lentiviral human FHL5 sgRNA gene knockout kit (100)
GTR15368824 1 Vial

Lentiviral human FHL5 sgRNA gene knockout kit - Lentiviral human FHL5 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
AKT3, CT (RAC-gamma Serine/Threonine-protein Kinase, RAC-PK-gamma, Protein Kinase Akt-3, Protein Kinase B, gamma, PKB gamma, STK-2, PKBG) (MaxLight 405)
MBS6462154-01 0.1 mL

AKT3, CT (RAC-gamma Serine/Threonine-protein Kinase, RAC-PK-gamma, Protein Kinase Akt-3, Protein Kinase B, gamma, PKB gamma, STK-2, PKBG) (MaxLight 405)

Sign In for Pricing
View Details
AKT3, CT (RAC-gamma Serine/Threonine-protein Kinase, RAC-PK-gamma, Protein Kinase Akt-3, Protein Kinase B, gamma, PKB gamma, STK-2, PKBG) (MaxLight 405)
MBS6462154-02 5x 0.1 mL

AKT3, CT (RAC-gamma Serine/Threonine-protein Kinase, RAC-PK-gamma, Protein Kinase Akt-3, Protein Kinase B, gamma, PKB gamma, STK-2, PKBG) (MaxLight 405)

Sign In for Pricing
View Details