Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative aliphatic sulfonates transport permease protein ssuC (ssuC)

This Recombinant Bacillus subtilis Putative aliphatic sulfonates transport permease protein ssuC (ssuC) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Putative aliphatic sulfonates transport permease protein ssuC

UniProt

P40401

Expression Region

1-276

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMKAEAAGSLPKTNAEAVRKKPGRKRYGWMKGLLLPAVIIAIWQVIGGLGVVSATVLPTP VTIVLTFKELILSGELFGHLQISIYRAALGFLLGAGLGLMIGILAGFSKRTELYLDPSLQ MLRTVPHLAVTPLFILWFGFDEVSKILLIALGAFFPVYINTFNGIRGVDAKLFEVARVLE FKWHQQISKVILPAALPNILLGIRLSLGIAWLGLVVAELMGSSSGVGYMIMDARQFSQTN KVFAGIIIFAVVGKLTDSFVRLLERKLLKWRNSYEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pentachlorophenyl dodecanoate
OR55322-01 250 mg

Pentachlorophenyl dodecanoate

Sign In for Pricing
View Details
Pentachlorophenyl dodecanoate
OR55322-02 1 g

Pentachlorophenyl dodecanoate

Sign In for Pricing
View Details
RN5S198 Protein Vector (Human) (pPB-N-His)
PV116347 500 ng

RN5S198 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA Kit
YLA0110RB-01 48 Tests

Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA Kit

Sign In for Pricing
View Details
Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA Kit
YLA0110RB-02 96 Tests

Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA Kit

Sign In for Pricing
View Details
Anti-Prolactin Receptor/PRLR Antibody Picoband®, PE Conjugate
PA2087-PE 100 µg/Vial

Anti-Prolactin Receptor/PRLR Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details