Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Verminephrobacter eiseniae Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Verminephrobacter eiseniae Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A1WMU7

Expression Region

1-277

Origin

Verminephrobacter eiseniae (strain EF01-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIYPPIDPVALQIGPLAIHWYGLSYLAAFGLFMLLGCRRLRHPPFAGRTGPGAWSRKDV EDILFLGVAGVVLGGRLGYCLFYKPDYYLGHPLEVFALWQGGMAFHGGLLGVIVAMLWFA HSRQRPLLQVADFVAPCVPTGLAAGRVGNFINGELWGRFASPDLPWGMVFAHSGSMQPRH PSQVYQFLLEGLLLFVLLWLYARRERRQGQVAAAFLVGYGVLRFIAEQFREPDAFLGILA LGMSMGQWLCLPMIAGGVLLWCRAARRRPAVARGSRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOPC Protein Vector (Mouse) (pPM-C-HA)
22410024 500 ng

GOPC Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human CASP7 Protein (Sumo Tag)
MBS2580187-01 0.02 mg

Recombinant Human CASP7 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human CASP7 Protein (Sumo Tag)
MBS2580187-02 0.1 mg

Recombinant Human CASP7 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human CASP7 Protein (Sumo Tag)
MBS2580187-03 5x 0.1 mg

Recombinant Human CASP7 Protein (Sumo Tag)

Sign In for Pricing
View Details
Human IL7R/CD127  ELISA Kit
LF-EK50888 1×96T

Human IL7R/CD127 ELISA Kit

Sign In for Pricing
View Details
FXYD3 (NM_001136011) Human Tagged Lenti ORF Clone
RC227235L4 10 µg

FXYD3 (NM_001136011) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details